Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50031706 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_49466 (CHEMBL657110) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Senokuchi, K; Nakai, H; Nakayama, Y; Odagaki, Y; Sakaki, K; Kato, M; Maruyama, T; Miyazaki, T; Ito, H; Kamiyasu, K New orally active serine protease inhibitors. J Med Chem38:2521-3 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50031706 |
---|
n/a |
---|
Name | BDBM50031706 |
Synonyms: | 4-Guanidino-benzoic acid 4-dimethylcarbamoylmethoxycarbonylmethyl-phenyl ester; compound with methanesulfonic acid | CHEMBL85164 | Camostat | med.21724, Compound 18 |
Type | Small organic molecule |
Emp. Form. | C20H22N4O5 |
Mol. Mass. | 398.4125 |
SMILES | [#6]-[#7](-[#6])-[#6](=O)-[#6]-[#8]-[#6](=O)-[#6]-c1ccc(-[#8]-[#6](=O)-c2ccc(cc2)\[#7]=[#6](/[#7])-[#7])cc1 |
Structure |
|