Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-chymotrypsin
LigandBDBM50031706
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49466
IC50>100000±n/a nM
Citation Senokuchi KNakai HNakayama YOdagaki YSakaki KKato MMaruyama TMiyazaki TIto HKamiyasu K New orally active serine protease inhibitors. J Med Chem 38:2521-3 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-chymotrypsin
Name:Alpha-chymotrypsin
Synonyms:Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin)
Type:Serine protease
Mol. Mass.:25670.88
Organism:Bos taurus (bovine)
Description:n/a
Residue:245
Sequence:
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031706
n/a
NameBDBM50031706
Synonyms:4-Guanidino-benzoic acid 4-dimethylcarbamoylmethoxycarbonylmethyl-phenyl ester; compound with methanesulfonic acid | CHEMBL85164
TypeSmall organic molecule
Emp. Form.C20H22N4O5
Mol. Mass.398.4125
SMILES[#6]-[#7](-[#6])-[#6](=O)-[#6]-[#8]-[#6](=O)-[#6]-c1ccc(-[#8]-[#6](=O)-c2ccc(cc2)\[#7]=[#6](/[#7])-[#7])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: