| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50031707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49466 (CHEMBL657110) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Senokuchi, K; Nakai, H; Nakayama, Y; Odagaki, Y; Sakaki, K; Kato, M; Maruyama, T; Miyazaki, T; Ito, H; Kamiyasu, K New orally active serine protease inhibitors. J Med Chem38:2521-3 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50031707 |
|---|
| n/a |
|---|
| Name | BDBM50031707 |
|---|
| Synonyms: | 4-[(E)-2-(Allyl-carboxymethyl-carbamoyl)-propenyl]-benzoic acid 4-carbamimidoyl-phenyl ester; compound with methanesulfonic acid | CHEMBL85154 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N3O5 |
|---|
| Mol. Mass. | 421.4458 |
|---|
| SMILES | C\C(=C/c1ccc(cc1)C(=O)Oc1ccc(cc1)C(N)=N)C(=O)N(CC=C)CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
