Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium-transporting ATPase
LigandBDBM50032014
Substrate/Competitorn/a
Meas. Tech.ChEMBL_76067
pH7±n/a
IC50 61±n/a nM
Commentsextracted
Citation Leach CABrown THIfe RJKeeling DJParsons METheobald CJWiggall KJ Reversible inhibitors of the gastric (H+/K+)-ATPase. 4. Identification of an inhibitor with an intermediate duration of action. J Med Chem 38:2748-62 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Potassium-transporting ATPase
Name:Potassium-transporting ATPase
Synonyms:Potassium-transporting ATPase alpha chain 1/beta chain
Type:n/a
Mol. Mass.:n/a
Description:n/a
Components:This complex has 0 components.
Component 1
Name:Potassium-transporting ATPase
Synonyms:ATP4B | Gastric H(+)/K(+) ATPase subunit beta | Potassium-transporting ATPase beta chain | Potassium-transporting ATPase subunit beta | Proton pump beta chain | gp60-90
Type:n/a
Mol. Mass.:33083.09
Organism:Sus scrofa (Pig)
Description:n/a
Residue:290
Sequence:
MAALQEKKSCSQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMSGIFALCIY
VLMRTIDPYTPDYQDQLKSPGVTLRPDVYGEKGLDISYNVSDSTTWAGLAHTLHRFLAGY
SPAAQEGSINCTSEKYFFQESFLAPNHTKFSCKFTADMLQNCSGRPDPTFGFAEGKPCFI
IKMNRIVKFLPGNSTAPRVDCAFLDQPRDGPPLQVEYFPANGTYSLHYFPYYGKKAQPHY
SNPLVAAKLLNVPRNRDVVIVCKILAEHVSFDNPHDPYEGKVEFKLKIQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Potassium-transporting ATPase
Synonyms:Potassium-transporting ATPase | Potassium-transporting ATPase alpha chain 1
Type:Enzyme
Mol. Mass.:114279.23
Organism:Sus scrofa (Pig)
Description:P19156
Residue:1034
Sequence:
MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRGGGKRKEKLENMKKEMEINDHQLSVAE
LEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAI
CLIAFAIQASEGDLTTDDNLYLALALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQAT
VIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILQAQGRKVDNSSLTGESEPQTRSPE
CTHESPLETRNIAFFSTMCLEGTAQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEH
FVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKR
LASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHSADTTEDQSGQT
FDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGY
RERFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHVLVMKGAPERVLERCSSILIKGQELPL
DEQWREAFQTAYLSLGGLGERVLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVS
MIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRV
PVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGA
IVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFD
NLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESD
IMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQW
ENHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEMCQIADVLIRKTRRLSAFQQGFF
RNRILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPMPFGLLIFVYDEIRKLGV
RCCPGSWWDQELYY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032014
n/a
NameBDBM50032014
Synonyms:1-[8-(1-Hydroxy-ethyl)-4-(4-hydroxy-2-methyl-phenylamino)-quinolin-3-yl]-butan-1-one | CHEMBL316322
TypeSmall organic molecule
Emp. Form.C22H24N2O3
Mol. Mass.364.4376
SMILESCCCC(=O)c1cnc2c(cccc2c1Nc1ccc(O)cc1C)C(C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: