Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM22888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_86913
Ki 70±n/a nM
Citation Ganellin CRHosseini SKKhalaf YSTertiuk WArrang JMGarbarg MLigneau XSchwartz JC Design of potent non-thiourea H3-receptor histamine antagonists. J Med Chem 38:3342-50 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22888
n/a
NameBDBM22888
Synonyms:1-[4-(1H-imidazol-5-yl)butyl]-3-methylthiourea | Burimamide | CHEMBL12160
TypeSmall organic molecule
Emp. Form.C9H16N4S
Mol. Mass.212.315
SMILESCNC(=S)NCCCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: