Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1A
LigandBDBM50033117
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46332
Ki 3600±n/a nM
Citation Anderson RCBalestra MBell PADeems ROFillers WSFoley JEFraser JDMann WRRudin MVillhauer EB Antidiabetic agents: a new class of reversible carnitine palmitoyltransferase I inhibitors. J Med Chem 38:3448-50 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1A
Name:Carnitine palmitoyltransferase 1A
Synonyms:CPT I | CPT1-L | CPTI-L | Carnitine O-palmitoyltransferase I, liver isoform
Type:PROTEIN
Mol. Mass.:88147.11
Organism:Rattus norvegicus
Description:ChEMBL_887445
Residue:773
Sequence:
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPS
SWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPV
VGHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLL
ANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033117
n/a
NameBDBM50033117
Synonyms:CHEMBL114113 | [3-Carboxy-2-(hydroxy-tetradecyloxy-phosphoryloxy)-propyl]-trimethyl-ammonium
TypeSmall organic molecule
Emp. Form.C21H44NO6P
Mol. Mass.437.5509
SMILESCCCCCCCCCCCCCCOP([O-])(=O)O[C@H](CC(O)=O)C[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: