| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein-S-isoprenylcysteine O-methyltransferase |
|---|
| Ligand | BDBM50034280 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158698 (CHEMBL763229) |
|---|
| Ki | 8000±n/a nM |
|---|
| Citation |  Marciano, D; Ben-Baruch, G; Marom, M; Egozi, Y; Haklai, R; Kloog, Y Farnesyl derivatives of rigid carboxylic acids-inhibitors of ras-dependent cell growth. J Med Chem38:1267-72 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein-S-isoprenylcysteine O-methyltransferase |
|---|
| Name: | Protein-S-isoprenylcysteine O-methyltransferase |
|---|
| Synonyms: | ICMT_RAT | Icmt | Isoprenylcysteine carboxyl methyltransferase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26663.61 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_158698 |
|---|
| Residue: | 232 |
|---|
| Sequence: | ALLLLLYRPPHYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTT
VNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSAAGLLMVIFGEC
LRKVAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPIC
GVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVGL
|
|
|
|---|
| BDBM50034280 |
|---|
| n/a |
|---|
| Name | BDBM50034280 |
|---|
| Synonyms: | 2-Chloro-5-((2E,6E)-3,7,11-trimethyl-dodeca-2,6,10-trienylamino)-benzoic acid | CHEMBL23751 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H30ClNO2 |
|---|
| Mol. Mass. | 375.932 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]/[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#7]-c1ccc(Cl)c(c1)-[#6](-[#8])=O |
|---|
| Structure | 
|
|---|
Search and Browse
