| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-1 |
|---|
| Ligand | BDBM50034585 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_92368 (CHEMBL701582) |
|---|
| Ki | >4.3±n/a nM |
|---|
| Citation |  Deadman, JJ; Elgendy, S; Goodwin, CA; Green, D; Baban, JA; Patel, G; Skordalakes, E; Chino, N; Claeson, G; Kakkar, VV Characterization of a class of peptide boronates with neutral P1 side chains as highly selective inhibitors of thrombin. J Med Chem38:1511-22 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-1 |
|---|
| Name: | Kallikrein-1 |
|---|
| Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28874.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06870 |
|---|
| Residue: | 262 |
|---|
| Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
|---|
| BDBM50034585 |
|---|
| n/a |
|---|
| Name | BDBM50034585 |
|---|
| Synonyms: | CHEMBL285285 | Peptide boronate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H48BN3O6 |
|---|
| Mol. Mass. | 677.637 |
|---|
| SMILES | CC1(C)C2CC1[C@]1(C)OB(O[C@@H]1C2)C(Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
