Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50034580
Substrate/Competitorn/a
Meas. Tech.ChEMBL_92368
Ki 9.5±n/a nM
Citation Deadman JJElgendy SGoodwin CAGreen DBaban JAPatel GSkordalakes EChino NClaeson GKakkar VV Characterization of a class of peptide boronates with neutral P1 side chains as highly selective inhibitors of thrombin. J Med Chem 38:1511-22 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034580
n/a
NameBDBM50034580
Synonyms:CHEMBL418050 | Peptide boronate
TypeSmall organic molecule
Emp. Form.C46H52BN3O6
Mol. Mass.753.733
SMILESCC1(C)C2CC1[C@]1(C)OB(O[C@@H]1C2)C(Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)OCc1ccccc1)C(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: