Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50034669 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_63998 (CHEMBL673107) |
---|
Ki | 100±n/a nM |
---|
Citation | Desai, RC; Court, JC; Ferguson, E; Gordon, RJ; Hlasta, DJ; Dunlap, RP; Franke, CA Phosphonates and phosphinates: novel leaving groups for benzisothiazolone inhibitors of human leukocyte elastase. J Med Chem38:1571-4 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50034669 |
---|
n/a |
---|
Name | BDBM50034669 |
Synonyms: | CHEMBL290189 | Phosphoric acid dimethyl ester 1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester |
Type | Small organic molecule |
Emp. Form. | C10H12NO7PS |
Mol. Mass. | 321.244 |
SMILES | COP(=O)(OC)OCN1C(=O)c2ccccc2S1(=O)=O |
Structure |
|