Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50034677
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63982
Ki 0.1±n/a nM
Citation Desai RCCourt JCFerguson EGordon RJHlasta DJDunlap RPFranke CA Phosphonates and phosphinates: novel leaving groups for benzisothiazolone inhibitors of human leukocyte elastase. J Med Chem 38:1571-4 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034677
n/a
NameBDBM50034677
Synonyms:CHEMBL288810 | Phosphoric acid diethyl ester 4-isopropyl-1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester
TypeSmall organic molecule
Emp. Form.C15H22NO7PS
Mol. Mass.391.376
SMILESCCOP(=O)(OCC)OCN1C(=O)c2c(cccc2C(C)C)S1(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: