| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular retinoic acid-binding protein 1 |
|---|
| Ligand | BDBM50031459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52395 (CHEMBL661351) |
|---|
| IC50 | 900±n/a nM |
|---|
| Citation |  Vaezi, MF; Alam, M; Sani, BP; Rogers, TS; Simpson-Herren, L; Wille, JJ; Hill, DL; Doran, TI; Brouillette, WJ; Muccio, DD A conformationally defined 6-s-trans-retinoic acid isomer: synthesis, chemopreventive activity, and toxicity. J Med Chem37:4499-507 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular retinoic acid-binding protein 1 |
|---|
| Name: | Cellular retinoic acid-binding protein 1 |
|---|
| Synonyms: | CRABP1 | Cellular retinoic acid-binding protein I | RABP1_CHICK | cellular retinoic acid binding protein 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15660.02 |
|---|
| Organism: | Gallus gallus |
|---|
| Description: | ChEMBL_52265 |
|---|
| Residue: | 137 |
|---|
| Sequence: | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKIGESFEEETVDGRKCRSLATWENENKIYCKQTLIEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
|
|
|
|---|
| BDBM50031459 |
|---|
| n/a |
|---|
| Name | BDBM50031459 |
|---|
| Synonyms: | (2Z,4E6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-en-1-yl)nona-2,4,6,8-tetraenoic acid | (7E,9E,11E,13Z)-retinoic acid | 13-RA | 13-cis-Vitamin A acid | 13-cis-retinoic acid | CHEMBL547 | Neovitamin A acid | isotretinoin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H28O2 |
|---|
| Mol. Mass. | 300.4351 |
|---|
| SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C\C(O)=O |c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
