Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50036255 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159284 (CHEMBL878766) |
---|
IC50 | 190±n/a nM |
---|
Citation | Vazquez, ML; Bryant, ML; Clare, M; DeCrescenzo, GA; Doherty, EM; Freskos, JN; Getman, DP; Houseman, KA; Julien, JA; Kocan, GP Inhibitors of HIV-1 protease containing the novel and potent (R)-(hydroxyethyl)sulfonamide isostere. J Med Chem38:581-4 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50036255 |
---|
n/a |
---|
Name | BDBM50036255 |
Synonyms: | CHEMBL154197 | [(1S,2R)-3-(Benzenesulfonyl-benzyl-amino)-1-benzyl-2-hydroxy-propyl]-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C31H32N2O5S |
Mol. Mass. | 544.661 |
SMILES | O[C@H](CN(Cc1ccccc1)S(=O)(=O)c1ccccc1)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1 |
Structure |
|