Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50036258
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157540
Ki 57±n/a nM
Citation Vazquez MLBryant MLClare MDeCrescenzo GADoherty EMFreskos JNGetman DPHouseman KAJulien JAKocan GP Inhibitors of HIV-1 protease containing the novel and potent (R)-(hydroxyethyl)sulfonamide isostere. J Med Chem 38:581-4 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036258
n/a
NameBDBM50036258
Synonyms:((S)-1-{(1S,2R)-1-Benzyl-2-hydroxy-3-[methanesulfonyl-(3-methyl-butyl)-amino]-propylcarbamoyl}-2-carbamoyl-ethyl)-carbamic acid benzyl ester | CHEMBL154252
TypeSmall organic molecule
Emp. Form.C28H40N4O7S
Mol. Mass.576.705
SMILESCC(C)CCN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: