Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50036735
Substrate/Competitorn/a
Meas. Tech.ChEBML_226570
Ki 33±n/a nM
Citation Jaen JCCaprathe BWPugsley TAWise LDAkunne H Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. J Med Chem 36:3929-36 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036735
n/a
NameBDBM50036735
Synonyms:(R)-1-(4-Fluoro-phenyl)-4-(4-pyridin-2-yl-piperazin-1-yl)-butan-1-ol | CHEMBL339033
TypeSmall organic molecule
Emp. Form.C19H24FN3O
Mol. Mass.329.4118
SMILESO[C@H](CCCN1CCN(CC1)c1ccccn1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: