Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50037120 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157870 (CHEMBL879227) |
---|
Ki | 2700±n/a nM |
---|
Citation | Thompson, SK; Murthy, KH; Zhao, B; Winborne, E; Green, DW; Fisher, SM; DesJarlais, RL; Tomaszek, TA; Meek, TD; Gleason, JG Rational design, synthesis, and crystallographic analysis of a hydroxyethylene-based HIV-1 protease inhibitor containing a heterocyclic P1'--P2' amide bond isostere. J Med Chem37:3100-7 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50037120 |
---|
n/a |
---|
Name | BDBM50037120 |
Synonyms: | CHEMBL104523 | {(1S,2S,4R)-1-Benzyl-2-hydroxy-4-[5-(1-hydroxy-2-methyl-propyl)-1H-imidazol-2-yl]-5-phenyl-pentyl}-carbamic acid tert-butyl ester |
Type | Small organic molecule |
Emp. Form. | C30H41N3O4 |
Mol. Mass. | 507.6642 |
SMILES | CC(C)C(O)c1cnc([nH]1)[C@@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)OC(C)(C)C)Cc1ccccc1 |
Structure |
|