Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50037135
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138749
Ki 0.25±n/a nM
Citation Cheng CYHsin LWTsai MCSchmidt WKSmith CTam SW Synthesis and opioid activity of 7-oxygenated 2,3,4,4a,5,6,7,7a-octahydro-1H-benzofuro[3,2-e]isoquinolin-9-ols. J Med Chem 37:3121-7 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037135
n/a
NameBDBM50037135
Synonyms:(4aR,7aR,12bS)-3-Cyclopropylmethyl-9-hydroxy-2,3,4,4a,5,6-hexahydro-1H-8-oxa-3-aza-benzo[d]fluoren-7-one | CHEMBL106027
TypeSmall organic molecule
Emp. Form.C19H23NO3
Mol. Mass.313.3908
SMILESOc1cccc2c1O[C@H]1C(=O)CC[C@H]3CN(CC4CC4)CC[C@]213
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: