Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50037527
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159296
IC50 0.013000±n/a nM
Citation Dorsey BDLevin RBMcDaniel SLVacca JPGuare JPDarke PLZugay JAEmini EASchleif WAQuintero JC L-735,524: the design of a potent and orally bioavailable HIV protease inhibitor. J Med Chem 37:3443-51 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037527
n/a
NameBDBM50037527
Synonyms:(S)-1-[(2S,4R)-2-Hydroxy-4-((R)-(R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-4-(quinoline-8-sulfonyl)-piperazine-2-carboxylic acid tert-butylamide | CHEMBL116954
TypeSmall organic molecule
Emp. Form.C39H47N5O6S
Mol. Mass.713.885
SMILESCC(C)(C)NC(=O)[C@@H]1CN(CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)NC1[C@H](O)Cc2ccccc12)S(=O)(=O)c1cccc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: