Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50007164
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145564
Ki 0.64±n/a nM
Citation Giardina GClarke GDDondio GPetrone GSbacchi MVecchietti V Selective kappa-opioid agonists: synthesis and structure-activity relationships of piperidines incorporating on oxo-containing acyl group. J Med Chem 37:3482-91 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:KOR-1 | MSL-1 | OPIATE Kappa | OPRK1
Type:Enzyme
Mol. Mass.:42656.78
Organism:Mus musculus (Mouse)
Description:P33534
Residue:380
Sequence:
MESPIQIFRGDPGPTCSPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLESAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007164
n/a
NameBDBM50007164
Synonyms:(S)-1-(2-Pyrrolidin-1-ylmethyl-piperidin-1-yl)-2-(4-trifluoromethyl-phenyl)-ethanone(BRL 52656) | 1-((S)-2-Pyrrolidin-1-ylmethyl-piperidin-1-yl)-2-(4-trifluoromethyl-phenyl)-ethanone | 1-(2-Pyrrolidin-1-ylmethyl-piperidin-1-yl)-2-(4-trifluoromethyl-phenyl)-ethanone | BRL-52656 | CHEMBL433508
TypeSmall organic molecule
Emp. Form.C19H25F3N2O
Mol. Mass.354.4098
SMILESFC(F)(F)c1ccc(CC(=O)N2CCCC[C@H]2CN2CCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: