Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50037821 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159307 (CHEMBL769360) |
---|
IC50 | 1000±n/a nM |
---|
Citation | Kitchin, J; Bethell, RC; Cammack, N; Dolan, S; Evans, DN; Holman, S; Holmes, DS; McMeekin, P; Mo, CL; Nieland, N Synthesis and structure-activity relationships of a series of penicillin-derived HIV proteinase inhibitors: heterocyclic ring systems containing P1' and P2' substituents. J Med Chem37:3707-16 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50037821 |
---|
n/a |
---|
Name | BDBM50037821 |
Synonyms: | (2R,4S)-2-[Ethylcarbamoyl-((S)-phenylacetylamino)-methyl]-5,5-dimethyl-thiazolidine-4-carboxylic acid [3-((S)-1-tert-butylcarbamoyl-2-cyclohexyl-ethylamino)-2-hydroxy-propyl]-amide | CHEMBL122233 |
Type | Small organic molecule |
Emp. Form. | C34H56N6O5S |
Mol. Mass. | 660.911 |
SMILES | CCNC(=O)C(NC(=O)Cc1ccccc1)[C@@H]1N[C@@H](C(=O)NCC(O)CN[C@@H](CC2CCCCC2)C(=O)NC(C)(C)C)C(C)(C)S1 |
Structure |
|