Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAVPR1A
LigandBDBM50038599
Substrate/Competitorn/a
Meas. Tech.ChEMBL_215170
Ki 0.180000±n/a nM
Citation Carnazzi EAumelas ABarberis CGuillon GSeyer R A new series of photoactivatable and iodinatable linear vasopressin antagonists. J Med Chem 37:1841-9 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
AVPR1A
Name:Vasopressin receptor
Synonyms:VASOPRESSIN V1A | Vasopressin V1 receptor | Vasopressin V1a receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:47674.81
Organism:RAT
Description:VASOPRESSIN V1A AVPR1A RAT::P30560
Residue:424
Sequence:
MSFPRGSQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAKLEIAVLAV
IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP
DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFI
LSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGF
ICYHIWRNIRGKTASSRHSKGDKGSGEAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTF
VIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH
LLQDCVQSFPCCHSMAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGMWKDSPKSSKSIRFI
PVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038599
n/a
NameBDBM50038599
Synonyms:4-N3-C6H4CH2CH2CH2CO-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr(I)-NH2 | 4-N3-C6H4CH2CH2CH2CO-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 | CHEMBL405440
TypeSmall organic molecule
Emp. Form.C64H86N20O13
Mol. Mass.1343.4938
SMILESCN([C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O)C(=O)CCCc1ccc(cc1)N=[N+]=[N-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: