Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-specific 3',5'-cyclic phosphodiesterase
LigandBDBM50038991
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155842
IC50 19±n/a nM
Citation Takase YSaeki TWatanabe NAdachi HSouda SSaito I Cyclic GMP phosphodiesterase inhibitors. 2. Requirement of 6-substitution of quinazoline derivatives for potent and selective inhibitory activity. J Med Chem 37:2106-11 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cGMP-specific 3',5'-cyclic phosphodiesterase
Name:3',5'-cyclic phosphodiesterase
Synonyms:CGB-PDE | PDE5 | PDE5A | Phosphodiesterase 5 (PDE5) | Phosphodiesterase 5A | Phosphodiesterase 5A (PDE5A) | cGMP-binding cGMP-specific phosphodiesterase
Type:Protein
Mol. Mass.:99975.83
Organism:Homo sapiens (Human)
Description:O76074
Residue:875
Sequence:
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038991
n/a
NameBDBM50038991
Synonyms:Benzo[1,3]dioxol-5-ylmethyl-(6-chloro-quinazolin-4-yl)-amine | CHEMBL66620
TypeSmall organic molecule
Emp. Form.C16H12ClN3O2
Mol. Mass.313.738
SMILESClc1ccc2ncnc(NCc3ccc4OCOc4c3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: