Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM10755 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1974 (CHEMBL617579) |
---|
IC50 | 3±n/a nM |
---|
Citation | Macor, JE; Blank, DH; Fox, CB; Lebel, LA; Newman, ME; Post, RJ; Ryan, K; Schmidt, AW; Schulz, DW; Koe, BK 5-[(3-nitropyrid-2-yl)amino]indoles: novel serotonin agonists with selectivity for the 5-HT1D receptor. Variation of the C3 substituent on the indole template leads to increased 5-HT1D receptor selectivity. J Med Chem37:2509-12 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5-HT-1D | 5-HT1D | 5-hydroxytryptamine receptor 1D | 5HT1D_RAT | Htr1d | Serotonin 1 (5-HT1) receptor | Serotonin 1B/1D receptor | Serotonin receptor 1D |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 41551.75 |
Organism: | RAT |
Description: | 5-HT1D HTR1D RAT::P28565 |
Residue: | 374 |
Sequence: | MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQRVVHFRKAS
|
|
|
BDBM10755 |
---|
n/a |
---|
Name | BDBM10755 |
Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
Type | Small organic molecule |
Emp. Form. | C10H12N2O |
Mol. Mass. | 176.2151 |
SMILES | NCCc1c[nH]c2ccc(O)cc12 |
Structure |
|