Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVesicular acetylcholine transporter
LigandBDBM50039620
Substrate/Competitorn/a
Meas. Tech.ChEMBL_213554
Ki 0.638±n/a nM
Citation Efange SMKhare ABFoulon CAkella SKParsons SM Spirovesamicols: conformationally restricted analogs of 2-(4-phenylpiperidino)cyclohexanol (vesamicol, AH5183) as potential modulators of presynaptic cholinergic function. J Med Chem 37:2574-82 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Vesicular acetylcholine transporter
Name:Vesicular acetylcholine transporter
Synonyms:TorVAChT | VAChT
Type:PROTEIN
Mol. Mass.:56111.93
Organism:Torpedo californica
Description:ChEMBL_1503355
Residue:515
Sequence:
MGVTMAVGLAKAAMGKISSAIGERSKRISGAMNEPRRKRKILLVIVCIAMLLDNMLYMVI
VPIIPNYLETIRTYKLVYITTPSNGTNGSLLNSTQRAVLERNPNANEDIQIGVLFASKAI
LQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAVLFAARSLQGLGSAFAD
TSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFLVLSFVCL
LDGILLLMVVTPFASRTRENMLQGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTISNW
MKKTMNASEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWFYGAVGLVIIGASSCTIP
ACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALG
PIMAGQIVHDLGFVQLNLGMGLVNILYAPALLFLRNVCQMKPSLSERNILLEEGPKGLYD
TIIMEERKAAKEPHGSSSGNHSVHAVLSDQEGYSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039620
n/a
NameBDBM50039620
Synonyms:1-(4-iodobenzyl)-3-spiro[1,2,3,4-tetrahydronaphthalene-1,4'-(hexahydropyridine)]-1-yl-(3R,4R)-hexahydro-4-pyridinol | CHEMBL87232
TypeSmall organic molecule
Emp. Form.C26H33IN2O
Mol. Mass.516.4575
SMILESO[C@@H]1CCN(Cc2ccc(I)cc2)C[C@H]1N1CCC2(CCCc3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: