Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPDGFR-beta/Platelet-derived growth factor receptor alpha
LigandBDBM50040919
Substrate/Competitorn/a
Meas. Tech.ChEMBL_454
IC50>100000±n/a nM
Citation Trinks UBuchdunger EFuret PKump WMett HMeyer TMüller MRegenass URihs GLydon N Dianilinophthalimides: potent and selective, ATP-competitive inhibitors of the EGF-receptor protein tyrosine kinase. J Med Chem 37:1015-27 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
PDGFR-beta/Platelet-derived growth factor receptor alpha
Name:PDGFR-beta/Platelet-derived growth factor receptor alpha
Synonyms:Platelet-derived growth factor receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 454
Components:This complex has 2 components.
Component 1
Name:Platelet-derived growth factor receptor beta
Synonyms:Beta platelet-derived growth factor receptor | Beta-type platelet-derived growth factor receptor | CD140 antigen-like family member B | CD140b antigen | CD_antigen=CD140b | PDGF-R-beta | PDGFR-beta | Platelet-Derived Growth Factor Receptor, beta | Platelet-derived growth factor receptor
Type:Enzyme
Mol. Mass.:122771.00
Organism:Mus musculus (mouse)
Description:P05622
Residue:1098
Sequence:
MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSG
AGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALP
VGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTYLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDY
IIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQ
PQDSGCPGPLAEAEDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Platelet-derived growth factor receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:122646.66
Organism:Mus musculus
Description:EBI_12628
Residue:1089
Sequence:
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPEIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVSFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040919
n/a
NameBDBM50040919
Synonyms:5,6-Bis-(biphenyl-4-ylamino)-isoindole-1,3-dione | CHEMBL7929
TypeSmall organic molecule
Emp. Form.C32H23N3O2
Mol. Mass.481.5439
SMILESO=C1NC(=O)c2cc(Nc3ccc(cc3)-c3ccccc3)c(Nc3ccc(cc3)-c3ccccc3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: