Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclic AMP-dependent protein kinase (PKA)
LigandBDBM50040914
Substrate/Competitorn/a
Meas. Tech.ChEMBL_152945
IC50>500000±n/a nM
Citation Trinks UBuchdunger EFuret PKump WMett HMeyer TMüller MRegenass URihs GLydon N Dianilinophthalimides: potent and selective, ATP-competitive inhibitors of the EGF-receptor protein tyrosine kinase. J Med Chem 37:1015-27 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cyclic AMP-dependent protein kinase (PKA)
Name:Cyclic AMP-dependent protein kinase (PKA)
Synonyms:PKA catalytic subunit alpha | Serine/threonine-protein kinase | cAMP-dependent protein kinase alpha-catalytic subunit
Type:Enzyme
Mol. Mass.:40766.33
Organism:Oryctolagus cuniculus (Rabbit)
Description:Q95J97
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAQLDQFERIKTLGTGSFGRVML
SKHKETGNHYAMKILDKQKVVKLKQIEHTLNVKRILQAVNFPFLVKLEFSFKENSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQQTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAADYPPFF
ADQPIQIYEKIVYGKVRFPSHFSSDLKDLLRNLQQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040914
n/a
NameBDBM50040914
Synonyms:5-(4-Methoxy-phenylamino)-6-phenylamino-isoindole-1,3-dione | CHEMBL8095
TypeSmall organic molecule
Emp. Form.C21H17N3O3
Mol. Mass.359.378
SMILESCOc1ccc(Nc2cc3C(=O)NC(=O)c3cc2Nc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: