Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50041621
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65650
Ki 422.0±n/a nM
Citation Elliott JDLago MACousins RDGao ALeber JDErhard KFNambi PElshourbagy NAKumar CLee JA 1,3-Diarylindan-2-carboxylic acids, potent and selective non-peptide endothelin receptor antagonists. J Med Chem 37:1553-7 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041621
n/a
NameBDBM50041621
Synonyms:(1R,2R,3S)-1,3-Bis-(4-methoxy-phenyl)-indan-2-carboxylic acid | CHEMBL290026
TypeSmall organic molecule
Emp. Form.C24H22O4
Mol. Mass.374.4291
SMILESCOc1ccc(cc1)[C@H]1[C@@H]([C@H](c2ccccc12)c1ccc(OC)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: