Reaction Details |
| Report a problem with these data |
Target | 3',5'-cyclic-AMP phosphodiesterase |
---|
Ligand | BDBM50041853 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157209 (CHEMBL768860) |
---|
IC50 | 2±n/a nM |
---|
Citation | Ashton, MJ; Cook, DC; Fenton, G; Karlsson, JA; Palfreyman, MN; Raeburn, D; Ratcliffe, AJ; Souness, JE; Thurairatnam, S; Vicker, N Selective type IV phosphodiesterase inhibitors as antiasthmatic agents. The syntheses and biological activities of 3-(cyclopentyloxy)-4-methoxybenzamides and analogues. J Med Chem37:1696-703 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3',5'-cyclic-AMP phosphodiesterase |
---|
Name: | 3',5'-cyclic-AMP phosphodiesterase |
Synonyms: | Phosphodiesterase 4A |
Type: | PROTEIN |
Mol. Mass.: | 13615.65 |
Organism: | Sus scrofa |
Description: | ChEMBL_155848 |
Residue: | 118 |
Sequence: | PWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVDIPSPTMKDHEKQQ
APRQRPSQQPPPPGPQFQPMSQITGVKKLMHSSSLNEDSSIPRFGVKTDQEELLAQEL
|
|
|
BDBM50041853 |
---|
n/a |
---|
Name | BDBM50041853 |
Synonyms: | 3-Cyclopentyloxy-N-(3,5-dichloro-1-oxy-pyridin-4-yl)-4-methoxy-benzamide | CHEMBL45395 |
Type | Small organic molecule |
Emp. Form. | C18H18Cl2N2O4 |
Mol. Mass. | 397.253 |
SMILES | COc1ccc(cc1OC1CCCC1)C(=O)Nc1c(Cl)c[n+]([O-])cc1Cl |
Structure |
|