| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50041948 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_158994 |
|---|
| IC50 | 9.9±n/a nM |
|---|
| Citation |  Wonacott, A; Cooke, R; Hayes, FR; Hann, MM; Jhoti, H; McMeekin, P; Mistry, A; Murray-Rust, P; Singh, OM; Weir, MP A series of penicillin-derived C2-symmetric inhibitors of HIV-1 proteinase: structural and modeling studies. J Med Chem36:3113-9 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50041948 |
|---|
| n/a |
|---|
| Name | BDBM50041948 |
|---|
| Synonyms: | 4N-{2-[5-ethylcarbamoyl(2-phenylphenylcarboxamido)methyl-2,2,4-trimethyl-(3S,5S)-tetrahydro-3-thiophenylcarboxamido]ethyl}-2-ethylcarbamoyl(2-phenylphenylcarboxamido)methyl-5,5-dimethyl-(2R,4S)-1,3-thiazolane-4-carboxamide | CHEMBL323318 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H58N8O6S2 |
|---|
| Mol. Mass. | 907.154 |
|---|
| SMILES | CCNC(=O)[C@@H](NC(=O)c1ccccc1-c1ccccc1)[C@@H]1NC(C(=O)NCCNC(=O)[C@@H]2N[C@H](SC2(C)C)[C@H](NC(=O)c2ccccc2-c2ccccc2)C(=O)NCC)C(C)(C)S1 |
|---|
| Structure | 
|
|---|
Search and Browse
