| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50042185 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_99828 |
|---|
| Ki | 3500±n/a nM |
|---|
| Citation |  Boehm, JC; Gleason, JG; Pendrak, I; Sarau, HM; Schmidt, DB; Foley, JJ; Kingsbury, WD Synthesis and LTB4 receptor antagonist activities of the naturally occurring LTB4 receptor antagonist Leucettamine A and related analogues. J Med Chem36:3333-40 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50042185 |
|---|
| n/a |
|---|
| Name | BDBM50042185 |
|---|
| Synonyms: | 4,5-Bis-benzo[1,3]dioxol-5-ylmethyl-1-methyl-1H-imidazol-2-ylamine | CHEMBL111825 | leucettamine A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19N3O4 |
|---|
| Mol. Mass. | 365.3826 |
|---|
| SMILES | Cn1c(N)nc(Cc2ccc3OCOc3c2)c1Cc1ccc2OCOc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
