Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-2 (m-Calpain)
LigandBDBM50042434
Substrate/Competitorn/a
Meas. Tech.ChEBML_43855
pH8±n/a
Ki 59±n/a nM
Commentsextracted
Citation Li ZPatil GSGolubski ZEHori HTehrani KForeman JEEveleth DDBartus RTPowers JC Peptide alpha-keto ester, alpha-keto amide, and alpha-keto acid inhibitors of calpains and other cysteine proteases. J Med Chem 36:3472-80 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Calpain-2 (m-Calpain)
Name:Calpain1/2
Synonyms:CANP 2 | Calcium-activated neutral proteinase 2 | Calpain 2 | Calpain M-type | Calpain large polypeptide L2 | Calpain-2 catalytic subunit | Calpain-2 large subunit | Calpain1/2 | M-calpain | Millimolar-calpain | calpain
Type:Protein
Mol. Mass.:79965.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042434
n/a
NameBDBM50042434
Synonyms:CHEMBL116256 | {3-Methyl-1-[1-(2-phenyl-propylaminooxalyl)-propylcarbamoyl]-butyl}-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C28H37N3O5
Mol. Mass.495.6105
SMILESCCC(NC(=O)C(CC(C)C)NC(=O)OCc1ccccc1)C(=O)C(=O)NCC(C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: