Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPapain
LigandBDBM50042427
Substrate/Competitorn/a
Meas. Tech.ChEBML_152654
pH6±n/a
Ki 38000±n/a nM
Commentsextracted
Citation Li ZPatil GSGolubski ZEHori HTehrani KForeman JEEveleth DDBartus RTPowers JC Peptide alpha-keto ester, alpha-keto amide, and alpha-keto acid inhibitors of calpains and other cysteine proteases. J Med Chem 36:3472-80 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Papain
Name:Papain
Synonyms:Allergen=Car p 1 | PPI | Papaya proteinase I
Type:Enzyme
Mol. Mass.:38923.01
Organism:Carica papaya
Description:Papain was purchased from Sigma, Germany.
Residue:345
Sequence:
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK
NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE
LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE
YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT
DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG
PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042427
n/a
NameBDBM50042427
Synonyms:CHEMBL118025 | [1-(1-Benzylaminooxalyl-propylcarbamoyl)-3-methyl-butyl]-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C26H33N3O5
Mol. Mass.467.5573
SMILESCCC(NC(=O)C(CC(C)C)NC(=O)OCc1ccccc1)C(=O)C(=O)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: