Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM50042387
Substrate/Competitorn/a
Meas. Tech.ChEBML_47386
pH5.2±n/a
Ki 1500±n/a nM
Commentsextracted
Citation Li ZPatil GSGolubski ZEHori HTehrani KForeman JEEveleth DDBartus RTPowers JC Peptide alpha-keto ester, alpha-keto amide, and alpha-keto acid inhibitors of calpains and other cysteine proteases. J Med Chem 36:3472-80 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:BCSB | Cathepsin B precursor | Cathepsin B1
Type:Enzyme
Mol. Mass.:36657.87
Organism:Bos taurus (bovine)
Description:Bovine spleen CB was purchased from Sigma Co. (USA).
Residue:335
Sequence:
MWRLLATLSCLLVLTSARSSLYFPPLSDELVNFVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGMPCTHQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042387
n/a
NameBDBM50042387
Synonyms:3-(2-Benzyloxycarbonylamino-4-methyl-pentanoylamino)-2-oxo-pentanoic acid | CHEMBL118908
TypeSmall organic molecule
Emp. Form.C19H26N2O6
Mol. Mass.378.4195
SMILESCCC(NC(=O)C(CC(C)C)NC(=O)OCc1ccccc1)C(=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: