Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM50042739
Substrate/Competitorn/a
Meas. Tech.ChEBML_35414
IC50 3500±n/a nM
Citation Dhanoa DSBagley SWChang RSLotti VJChen TBKivlighn SDZingaro GJSiegl PKChakravarty PKPatchett AA (Dipropylphenoxy)phenylacetic acids: a new generation of nonpeptide angiotensin II receptor antagonists. J Med Chem 36:3738-42 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042739
n/a
NameBDBM50042739
Synonyms:(2-Chloro-phenyl)-[4-(2-ethyl-5,7-dimethyl-imidazo[4,5-b]pyridin-3-ylmethyl)-2,6-dipropyl-phenoxy]-acetic acid | CHEMBL123084
TypeSmall organic molecule
Emp. Form.C31H36ClN3O3
Mol. Mass.534.089
SMILESCCCc1cc(Cn2c(CC)nc3c(C)cc(C)nc23)cc(CCC)c1OC(C(O)=O)c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: