Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor
LigandBDBM50029460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99841
Ki 36±n/a nM
Citation Sawyer JSBaldwin RFSofia MJFloreancig PMarder PSaussy DLFroelich LLSilbaugh SAStengel PWCockerham SL Biphenylyl-substituted xanthones: highly potent leukotriene B4 receptor antagonists. J Med Chem 36:3982-4 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029460
n/a
NameBDBM50029460
Synonyms:3-{3-[3-(5-Ethyl-4'-fluoro-2-hydroxy-biphenyl-4-yloxy)-propoxy]-9-oxo-9H-xanthen-4-yl}-propionic acid | CHEMBL129463
TypeSmall organic molecule
Emp. Form.C33H29FO7
Mol. Mass.556.5776
SMILESCCc1cc(c(O)cc1OCCCOc1ccc2c(oc3ccccc3c2=O)c1CCC(O)=O)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: