Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 5-lipoxygenase
LigandBDBM32020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3983
IC50 400±n/a nM
Citation Müller KGürster DPiwek SWiegrebe W Antipsoriatic anthrones with modulated redox properties. 1. Novel 10-substituted 1,8-dihydroxy-9(10H)-anthracenones as inhibitors of 5-lipoxygenase. J Med Chem 36:4099-107 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 5-lipoxygenase
Name:Arachidonate 5-lipoxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49994.23
Organism:Bos taurus
Description:ChEMBL_157766
Residue:430
Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGDIQLIKIEKRKYWFHDDWYLKYITVKTPCGDYIEFPCYRWISGEGEIVLRDGQAKLA
CDDQIHVLKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWSDFADFEKIFVRISNTISERVMNHWQEDRMFGYQFLNG
CNPVMIQRCLKLPDNLPVTTEMVECSLERQLTLEQEIEQGNIFIVDFKLLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQVPGEENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32020
n/a
NameBDBM32020
Synonyms:4-[4-(3,4-dihydroxyphenyl)-2,3-dimethyl-butyl]pyrocatechol | 4-[4-(3,4-dihydroxyphenyl)-2,3-dimethylbutyl]benzene-1,2-diol | 4-[4-[3,4-bis(oxidanyl)phenyl]-2,3-dimethyl-butyl]benzene-1,2-diol | BDBM166684 | CHEMBL52 | LOX inhibitor, N/A | MLS000069451 | NORDIHYDROGUAIARETIC ACID | Nordihydroguaiaretic acid (NDGA) | SMR000059049 | cid_4534
TypeSmall organic molecule
Emp. Form.C18H22O4
Mol. Mass.302.3649
SMILESCC(Cc1ccc(O)c(O)c1)C(C)Cc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: