Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50043451
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36940
IC50 1±n/a nM
Citation Dhanoa DSBagley SWChang RSLotti VJChen TBKivlighn SDZingaro GJSiegl PKPatchett AAGreenlee WJ Non-peptide angiotensin II receptor antagonists. 2. Design, synthesis, and biological activity of N-substituted (phenylamino)phenylacetic acids and acyl sulfonamides. J Med Chem 36:4239-49 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043451
n/a
NameBDBM50043451
Synonyms:CHEMBL337006 | N-(2-{Allyl-[4-(2-ethyl-5,7-dimethyl-imidazo[4,5-b]pyridin-3-ylmethyl)-phenyl]-amino}-2-phenyl-acetyl)-benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C34H35N5O3S
Mol. Mass.593.738
SMILESCCc1nc2c(C)cc(C)nc2n1Cc1ccc(cc1)N(CC=C)C(C(=O)NS(=O)(=O)c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: