Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase P |
---|
Ligand | BDBM50043759 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_72451 (CHEMBL686006) |
---|
Ki | 710000±n/a nM |
---|
Citation | Lyttle, MH; Hocker, MD; Hui, HC; Caldwell, CG; Aaron, DT; Engqvist-Goldstein, A; Flatgaard, JE; Bauer, KE Isozyme-specific glutathione-S-transferase inhibitors: design and synthesis. J Med Chem37:189-94 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutathione S-transferase P |
---|
Name: | Glutathione S-transferase P |
Synonyms: | FAEES3 | GST class-pi | GST3 | GSTP1 | GSTP1-1 | GSTP1_HUMAN | Glutathione S-transferase | Glutathione S-transferase (GST) | Glutathione S-transferase P | Glutathione S-transferase Pi | Glutathione transferase (GST) |
Type: | Enzyme |
Mol. Mass.: | 23353.53 |
Organism: | Homo sapiens (Human) |
Description: | P09211 |
Residue: | 210 |
Sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
|
|
|
BDBM50043759 |
---|
n/a |
---|
Name | BDBM50043759 |
Synonyms: | 2-Amino-4-[2-benzylsulfanyl-1-(2-carboxy-ethylcarbamoyl)-ethylcarbamoyl]-butyric acid | CHEMBL58451 |
Type | Small organic molecule |
Emp. Form. | C18H25N3O6S |
Mol. Mass. | 411.473 |
SMILES | NC(CCC(=O)NC(CSCc1ccccc1)C(=O)NCCC(O)=O)C(O)=O |
Structure |
|