| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glutathione S-transferase A1 |
|---|
| Ligand | BDBM50043763 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_72446 (CHEMBL682616) |
|---|
| Ki | 43000±n/a nM |
|---|
| Citation |  Lyttle, MH; Hocker, MD; Hui, HC; Caldwell, CG; Aaron, DT; Engqvist-Goldstein, A; Flatgaard, JE; Bauer, KE Isozyme-specific glutathione-S-transferase inhibitors: design and synthesis. J Med Chem37:189-94 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glutathione S-transferase A1 |
|---|
| Name: | Glutathione S-transferase A1 |
|---|
| Synonyms: | GST class-alpha member 1 | GST-epsilon | GSTA1 | GSTA1-1 | GSTA1_HUMAN | GTH1 | Glutathione S-transferase (GST) | HA subunit 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25636.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Glutathione-S-Transferase (GST, N-terminally) |
|---|
| Residue: | 222 |
|---|
| Sequence: | MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
|
|
|
|---|
| BDBM50043763 |
|---|
| n/a |
|---|
| Name | BDBM50043763 |
|---|
| Synonyms: | 2-Amino-4-[1-(2-carboxy-ethylcarbamoyl)-2-(4-methyl-benzylsulfanyl)-ethylcarbamoyl]-butyric acid | CHEMBL301229 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27N3O6S |
|---|
| Mol. Mass. | 425.499 |
|---|
| SMILES | Cc1ccc(CSCC(NC(=O)CCC(N)C(O)=O)C(=O)NCCC(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
