Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase A1 |
---|
Ligand | BDBM50043760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_72446 (CHEMBL682616) |
---|
Ki | 14700±n/a nM |
---|
Citation | Lyttle, MH; Hocker, MD; Hui, HC; Caldwell, CG; Aaron, DT; Engqvist-Goldstein, A; Flatgaard, JE; Bauer, KE Isozyme-specific glutathione-S-transferase inhibitors: design and synthesis. J Med Chem37:189-94 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutathione S-transferase A1 |
---|
Name: | Glutathione S-transferase A1 |
Synonyms: | GST class-alpha member 1 | GST-epsilon | GSTA1 | GSTA1-1 | GSTA1_HUMAN | GTH1 | Glutathione S-transferase (GST) | HA subunit 1 |
Type: | Enzyme |
Mol. Mass.: | 25636.31 |
Organism: | Homo sapiens (Human) |
Description: | Glutathione-S-Transferase (GST, N-terminally) |
Residue: | 222 |
Sequence: | MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
|
|
|
BDBM50043760 |
---|
n/a |
---|
Name | BDBM50043760 |
Synonyms: | 2-Amino-4-[1-[(carboxy-phenyl-methyl)-carbamoyl]-2-(4-chloro-benzylsulfanyl)-ethylcarbamoyl]-butyric acid | CHEMBL442360 |
Type | Small organic molecule |
Emp. Form. | C23H26ClN3O6S |
Mol. Mass. | 507.987 |
SMILES | NC(CCC(=O)NC(CSCc1ccc(Cl)cc1)C(=O)NC(C(O)=O)c1ccccc1)C(O)=O |
Structure |
|