Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50034435
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65824
Ki 55±n/a nM
Citation Stein PDHunt JTFloyd DMMoreland SDickinson KEMitchell CLiu ECWebb MLMurugesan NDickey J The discovery of sulfonamide endothelin antagonists and the development of the orally active ETA antagonist 5-(dimethylamino)-N-(3,4-dimethyl-5-isoxazolyl)-1-naphthalenesulf onamide. J Med Chem 37:329-31 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034435
n/a
NameBDBM50034435
Synonyms:5-Dimethylamino-naphthalene-1-sulfonic acid (3,4-dimethyl-2,3-dihydro-oxazol-5-yl)-amide | 5-Dimethylamino-naphthalene-1-sulfonic acid (3,4-dimethyl-isoxazol-5-yl)-amide | 5-Dimethylamino-naphthalene-1-sulfonic acid (3,4-dimethyl-isoxazol-5-yl)-amide (BMS 182874) | BMS-182874 | CHEMBL267458
TypeSmall organic molecule
Emp. Form.C17H19N3O3S
Mol. Mass.345.416
SMILESCN(C)c1cccc2c(cccc12)S(=O)(=O)Nc1onc(C)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: