Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM60212
Substrate/Competitorn/a
Meas. Tech.ChEBML_220942
Ki 6±n/a nM
Citation Mitch CHLeander JDMendelsohn LGShaw WNWong DTCantrell BEJohnson BGReel JKSnoddy JDTakemori AE 3,4-Dimethyl-4-(3-hydroxyphenyl)piperidines: opioid antagonists with potent anorectant activity. J Med Chem 36:2842-50 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60212
n/a
NameBDBM60212
Synonyms:(4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-bis(oxidanyl)-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride | (4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-dihydroxy-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride | MLS000069607 | NALTREXONE HYDROCHLORIDE | SMR000058767 | US9107954, naltrexone | cid_5485201
TypeSmall organic molecule
Emp. Form.C20H23NO4
Mol. Mass.341.4009
SMILESOc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: