Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50045891 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_218704 |
---|
Ki | 800±n/a nM |
---|
Citation | Kozikowski, AP; Ma, D; Brewer, J; Sun, S; Costa, E; Romeo, E; Guidotti, A Chemistry, binding affinities, and behavioral properties of a new class of"antineophobic" mitochondrial DBI receptor complex (mDRC) ligands. J Med Chem36:2908-20 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50045891 |
---|
n/a |
---|
Name | BDBM50045891 |
Synonyms: | 2-[2-(4-Chloro-phenyl)-1H-indol-3-yl]-N,N-dipropyl-propionamide | CHEMBL98809 |
Type | Small organic molecule |
Emp. Form. | C23H27ClN2O |
Mol. Mass. | 382.926 |
SMILES | CCCN(CCC)C(=O)C(C)c1c([nH]c2ccccc12)-c1ccc(Cl)cc1 |
Structure |
|