Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50046259
Substrate/Competitorn/a
Meas. Tech.ChEBML_140760
IC50 320±n/a nM
Citation Gomez-Monterrey ITurcaud SLucas EBruetschy LRoques BPFournié-Zaluski MC Exploration of neutral endopeptidase active site by a series of new thiol-containing inhibitors. J Med Chem 36:87-94 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CD10 antigen | CD_antigen=CD10 | Enkephalinase | NEP | Neutral Endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85570.75
Organism:Oryctolagus cuniculus (rabbit)
Description:NEP was purified to homogeneity from rabbit kidney.
Residue:750
Sequence:
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046259
n/a
NameBDBM50046259
Synonyms:2-[2-(2-Benzyl-3-mercapto-butyrylamino)-3-methyl-butyrylamino]-3-(4-hydroxy-phenyl)-propionic acid | CHEMBL176960
TypeSmall organic molecule
Emp. Form.C25H32N2O5S
Mol. Mass.472.597
SMILESCC(C)C(NC(=O)C(Cc1ccccc1)C(C)S)C(=O)NC(Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: