Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1A
LigandBDBM50046145
Substrate/Competitorn/a
Meas. Tech.ChEBML_46327
Ki 4200±n/a nM
Citation Gandour RDLeung OTGreway ATRamsay RRNic a'Bháird NFronczek FRBellard BMKumaravel G (+)-Hemipalmitoylcarnitinium strongly inhibits carnitine palmitoyltransferase-I in intact mitochondria. J Med Chem 36:237-42 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1A
Name:Carnitine palmitoyltransferase 1A
Synonyms:CPT I | CPT1-L | CPTI-L | Carnitine O-palmitoyltransferase I, liver isoform
Type:PROTEIN
Mol. Mass.:88147.11
Organism:Rattus norvegicus
Description:ChEMBL_887445
Residue:773
Sequence:
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPS
SWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPV
VGHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLL
ANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046145
n/a
NameBDBM50046145
Synonyms:2-[6-hydroxy-4,4-dimethyl-6-pentadecyl-(2R,6S)-1,4-oxazinan-4-ium-2-yl]acetate(hemipalmitoylcarnitinium (HPC)) | Acylcarnitine analogue | CHEMBL48257 | Hemiacylcarnitinium(+)-HPC
TypeSmall organic molecule
Emp. Form.C23H45NO4
Mol. Mass.399.6077
SMILESCCCCCCCCCCCCCCC[C@@]1(O)C[N+](C)(C)C[C@@H](CC([O-])=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: