Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50046355
Substrate/Competitorn/a
Meas. Tech.ChEMBL_213037
IC50 14±n/a nM
Citation Shuman RTRothenberger RBCampbell CSSmith GFGifford-Moore DSGesellchen PD Highly selective tripeptide thrombin inhibitors. J Med Chem 36:314-9 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046355
n/a
NameBDBM50046355
Synonyms:CHEMBL110898 | {2-[2-(1-Formyl-4-guanidino-butylcarbamoyl)-pyrrolidin-1-yl]-1-naphthalen-1-yl-2-oxo-ethyl}-carbamic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C28H38N6O5
Mol. Mass.538.6385
SMILESCC(C)(C)OC(=O)N[C@@H](C(=O)N1CCC[C@H]1C(=O)NC(CCCNC(N)=N)C=O)c1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: