Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50048281
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196012
Ki 40±n/a nM
Citation Charpentier BBernardon JMEustache JMillois CMartin BMichel SShroot B Synthesis, structure-affinity relationships, and biological activities of ligands binding to retinoic acid receptor subtypes. J Med Chem 38:4993-5006 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/gamma
Synonyms:Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor gamma
Type:PROTEIN
Mol. Mass.:50345.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1458016
Residue:454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048281
n/a
NameBDBM50048281
Synonyms:5',5',8',8'-Tetramethyl-5',6',7',8'-tetrahydro-[2,2']binaphthalenyl-6-carboxylic acid | 6-(5',6',7',8'-tetrahydro-5',5',8',8'-tetramethyl-2'-naphthalenyl)-2-naphthalenecarboxylic acid | CHEMBL25361
TypeSmall organic molecule
Emp. Form.C25H26O2
Mol. Mass.358.4727
SMILESCC1(C)CCC(C)(C)c2cc(ccc12)-c1ccc2cc(ccc2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: