Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50049085
Substrate/Competitorn/a
Meas. Tech.ChEMBL_910
Ki 1.3±n/a nM
Citation Glennon RAHong SSBondarev MLaw HDukat MRakhi SPower PFan EKinneau DKamboj RTeitler MHerrick-Davis KSmith C Binding of O-alkyl derivatives of serotonin at human 5-HT1D beta receptors. J Med Chem 39:314-22 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049085
n/a
NameBDBM50049085
Synonyms:1-[3-(2-Amino-ethyl)-1H-indol-5-yl]-ethanone | Acetryptine | CHEMBL110317
TypeSmall organic molecule
Emp. Form.C12H14N2O
Mol. Mass.202.2524
SMILESCC(=O)c1ccc2[nH]cc(CCN)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: