Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor gamma
LigandBDBM50049240
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154537
EC50 690.0±n/a nM
Citation Willson TMCobb JECowan DJWiethe RWCorrea IDPrakash SRBeck KDMoore LBKliewer SALehmann JM The structure-activity relationship between peroxisome proliferator-activated receptor gamma agonism and the antihyperglycemic activity of thiazolidinediones. J Med Chem 39:665-8 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor gamma
Name:Peroxisome proliferator-activated receptor gamma
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma
Type:PROTEIN
Mol. Mass.:57593.55
Organism:Mus musculus
Description:ChEMBL_1453700
Residue:505
Sequence:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049240
n/a
NameBDBM50049240
Synonyms:(+-)-5-((4-(2-(5-ethyl-2-pyridinyl)ethoxy)phenyl)methyl)-2,4-thiazolidinedione | 5-{4-[2-(5-ethylpyridin-2-yl)ethoxy]benzyl}-1,3-thiazolidine-2,4-dione | CHEMBL595 | PIOGLITAZONE | PIOGLITAZONE HYDROCHLORIDE
TypeSmall organic molecule
Emp. Form.C19H20N2O3S
Mol. Mass.356.439
SMILESCCc1ccc(CCOc2ccc(Cc3sc(=O)[nH]c3O)cc2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: