Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha
LigandBDBM50049241
Substrate/Competitorn/a
Meas. Tech.ChEMBL_153485
EC50 80000±n/a nM
Citation Willson TMCobb JECowan DJWiethe RWCorrea IDPrakash SRBeck KDMoore LBKliewer SALehmann JM The structure-activity relationship between peroxisome proliferator-activated receptor gamma agonism and the antihyperglycemic activity of thiazolidinediones. J Med Chem 39:665-8 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha
Name:Peroxisome proliferator-activated receptor alpha
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR-alpha
Type:PROTEIN
Mol. Mass.:52343.28
Organism:Mus musculus
Description:ChEMBL_572395
Residue:468
Sequence:
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049241
n/a
NameBDBM50049241
Synonyms:4-[4-(4-Chloro-phenoxy)-phenyl]-4-oxo-butyric acid | CHEMBL346267
TypeSmall organic molecule
Emp. Form.C16H13ClO4
Mol. Mass.304.725
SMILESOC(=O)CCC(=O)c1ccc(Oc2ccc(Cl)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: